Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10148)
Regulator Name Alpha-synuclein (SNCA)
Synonyms
NACP, PARK1; Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor
    Click to Show/Hide
Gene Name SNCA
Gene ID 6622
Regulator Type Protein coding
Uniprot ID P37840
Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA

    Click to Show/Hide
Family Synuclein family
Function
Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release. Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores. Mechanistically, acts by increasing local Ca(2+) release from microdomains which is essential for the enhancement of ATP-induced exocytosis. Acts also as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs (Soluble NSF Attachment Protein REceptors) at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5. This chaperone activity is important to sustain normal SNARE-complex assembly during aging. Also plays a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter (DAT1) and thereby modulating its activity.

    Click to Show/Hide
HGNC ID
HGNC:11138
KEGG ID hsa:6622
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
SNCA can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Parkinson disease ICD-11: 8A00
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 h-iPSCs (Human induced pluripotent stem cells)
hESCs (Human endometrial stromal cells)
Response regulation Variations in the SNCA gene that lead to increased -synuclein expression represent a genetic risk factor for sporadic parkinsons disease. a-synuclein aggregates may induce ferroptosis, and that inhibitors of ferroptosis prevent -synuclein-induced cell death.
Parkinson disease [ICD-11: 8A00]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Alpha-synuclein (SNCA) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 h-iPSCs (Human induced pluripotent stem cells)
hESCs (Human endometrial stromal cells)
Response regulation Variations in the SNCA gene that lead to increased -synuclein expression represent a genetic risk factor for sporadic parkinsons disease. a-synuclein aggregates may induce ferroptosis, and that inhibitors of ferroptosis prevent -synuclein-induced cell death.
References
Ref 1 Alpha synuclein aggregation drives ferroptosis: an interplay of iron, calcium and lipid peroxidation. Cell Death Differ. 2020 Oct;27(10):2781-2796. doi: 10.1038/s41418-020-0542-z. Epub 2020 Apr 27.