Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10120)
Regulator Name Cofilin-1 (CFL1)
Synonyms
CFL; 18 kDa phosphoprotein; Cofilin, non-muscle isoform
    Click to Show/Hide
Gene Name CFL1
Gene ID 1072
Regulator Type Protein coding
Uniprot ID P23528
Sequence
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV
GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS
KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

    Click to Show/Hide
Family Actin-binding proteins ADF family
Function
Binds to F-actin and exhibits pH-sensitive F-actin depolymerizing activity. In conjunction with the subcortical maternal complex (SCMC), plays an essential role for zygotes to progress beyond the first embryonic cell divisions via regulation of actin dynamics. Required for the centralization of the mitotic spindle and symmetric division of zygotes. Plays a role in the regulation of cell morphology and cytoskeletal organization in epithelial cells. Required for the up-regulation of atypical chemokine receptor ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chemokine uptake and degradation. Required for neural tube morphogenesis and neural crest cell migration.

    Click to Show/Hide
HGNC ID
HGNC:1874
KEGG ID hsa:1072
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
CFL1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Nervous system disease ICD-11: 8E7Z
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Gluconeogenesis hsa00010
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 HT22 cells Normal Mus musculus CVCL_0321
Response regulation Cofilin1 (CFL1) acts as a redox sensor in oxidative cell death pathways of ferroptosis, and also promotes glutamate excitotoxicity. Protective effects by cofilin1 inhibition are particularly attributed to preserved mitochondrial integrity and function. Thus, interfering with the oxidation and pathological activation of cofilin1 may offer an effective therapeutic strategy in neurodegenerative diseases.
Nervous system disease [ICD-11: 8E7Z]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Cofilin-1 (CFL1) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Gluconeogenesis hsa00010
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 HT22 cells Normal Mus musculus CVCL_0321
Response regulation Cofilin1 (CFL1) acts as a redox sensor in oxidative cell death pathways of ferroptosis, and also promotes glutamate excitotoxicity. Protective effects by cofilin1 inhibition are particularly attributed to preserved mitochondrial integrity and function. Thus, interfering with the oxidation and pathological activation of cofilin1 may offer an effective therapeutic strategy in neurodegenerative diseases.
References
Ref 1 Cofilin1 oxidation links oxidative distress to mitochondrial demise and neuronal cell death. Cell Death Dis. 2021 Oct 16;12(11):953. doi: 10.1038/s41419-021-04242-1.