Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10119)
Regulator Name Adenosylhomocysteinase (AHCY)
Synonyms
SAHH; S-adenosyl-L-homocysteine hydrolase
    Click to Show/Hide
Gene Name AHCY
Gene ID 191
Regulator Type Protein coding
Uniprot ID P23526
Sequence
MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVET
AVLIETLVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYF
KDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINV
NDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI
ITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIG
HFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSN
SFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMS
CDGPFKPDHYRY

    Click to Show/Hide
Family Adenosylhomocysteinase family
Function
Catalyzes the hydrolysis of S-adenosyl-L-homocysteine to form adenosine and homocysteine. Binds copper ions.

    Click to Show/Hide
HGNC ID
HGNC:343
KEGG ID hsa:191
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
AHCY can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Parkinson disease ICD-11: 8A00
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
PANC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
NCI-H292 cells Lung mucoepidermoid carcinoma Homo sapiens CVCL_0455
NCI-H838 cells Lung adenocarcinoma Homo sapiens CVCL_1594
786-O cells Renal cell carcinoma Homo sapiens CVCL_1051
KHOS cells Osteosarcoma Homo sapiens CVCL_2546
A2780 cells Ovarian endometrioid adenocarcinoma Homo sapiens CVCL_0134
HEK-293T cells Normal Homo sapiens CVCL_0063
In Vivo Model
Tumors were established by a subcutaneous injection of shRNA (control or DJ-1 KD) transfected H1299 cells (1,000,000/200 uL) into BALB/c female athymic nude mice (5 weeks, National Rodent Laboratory Animal Resource, Shanghai, China). Twelve days after injection, mice were randomly allocated into different groups and treated with vehicle (0.625% DMSO/99.375% HBSS (pH = 2)) or 30 mg/kg PE (tail intravenous injection, once every other day) for 16 days before the final tumor size was measured in all groups.

    Click to Show/Hide
Response regulation ACHYL1 is a interaction protein of DJ-1, which also has been known for negatively regulating SAHH (AHCY) activity via forming a heteromultimer complex. DJ-1 mutant neuronal cells experience high levels of ferroptosis, which might establish a potential mechanism via which DJ-1 could regulate early-onset recessive Parkinsons disease.
Parkinson disease [ICD-11: 8A00]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Adenosylhomocysteinase (AHCY) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
PANC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
NCI-H292 cells Lung mucoepidermoid carcinoma Homo sapiens CVCL_0455
NCI-H838 cells Lung adenocarcinoma Homo sapiens CVCL_1594
786-O cells Renal cell carcinoma Homo sapiens CVCL_1051
KHOS cells Osteosarcoma Homo sapiens CVCL_2546
A2780 cells Ovarian endometrioid adenocarcinoma Homo sapiens CVCL_0134
HEK-293T cells Normal Homo sapiens CVCL_0063
In Vivo Model
Tumors were established by a subcutaneous injection of shRNA (control or DJ-1 KD) transfected H1299 cells (1,000,000/200 uL) into BALB/c female athymic nude mice (5 weeks, National Rodent Laboratory Animal Resource, Shanghai, China). Twelve days after injection, mice were randomly allocated into different groups and treated with vehicle (0.625% DMSO/99.375% HBSS (pH = 2)) or 30 mg/kg PE (tail intravenous injection, once every other day) for 16 days before the final tumor size was measured in all groups.

    Click to Show/Hide
Response regulation ACHYL1 is a interaction protein of DJ-1, which also has been known for negatively regulating SAHH (AHCY) activity via forming a heteromultimer complex. DJ-1 mutant neuronal cells experience high levels of ferroptosis, which might establish a potential mechanism via which DJ-1 could regulate early-onset recessive Parkinsons disease.
References
Ref 1 DJ-1 suppresses ferroptosis through preserving the activity of S-adenosyl homocysteine hydrolase. Nat Commun. 2020 Mar 6;11(1):1251. doi: 10.1038/s41467-020-15109-y.