Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10105)
Regulator Name Dipeptidase 1 (DPEP1)
Synonyms
MDP , RDP; Beta-lactamase
    Click to Show/Hide
Gene Name DPEP1
Gene ID 1800
Regulator Type Protein coding
Uniprot ID P16444
Sequence
MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTT
LAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVT
SSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLV
DTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYS
VCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVG
FGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLT
QAPEEEPIPLDQLGGSCRTHYGYSSGASSLHRHWGLLLASLAPLVLCLSLL

    Click to Show/Hide
Family Peptidase M19 family
Function
Hydrolyzes a wide range of dipeptides including the conversion of leukotriene D4 to leukotriene E4. Hydrolyzes cystinyl- bis-glycine (cys-bis-gly) formed during glutathione degradation. Possesses also beta lactamase activity and can hydrolyze the beta-lactam antibiotic imipenem.

    Click to Show/Hide
HGNC ID
HGNC:3002
KEGG ID hsa:1800
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
DPEP1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Acute kidney failure ICD-11: GB60
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 NRK-52E cells Normal Rattus norvegicus CVCL_0468
In Vivo Model
For FA-induced nephropathy mouse models, 8-week-old male wild-type and Dpep1+/- or Chmp1a+/- mice were injected with FA (250 or 200 mg/kg, dissolved in 300 mM sodium bicarbonate) intraperitoneally and euthanized on day 7. For the cisplatin-induced injury model, 8-week-old male wild-type, Dpep1+/- or Chmp1a+/- mice were injected with cisplatin (25 or 20 mg/kg) intraperitoneally.

    Click to Show/Hide
Response regulation Both Dpep1 and Chmp1a are important regulators of a single pathway, ferroptosis and lead to acute kidney injury development via altering cellular iron trafficking.
Acute kidney failure [ICD-11: GB60]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Dipeptidase 1 (DPEP1) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 NRK-52E cells Normal Rattus norvegicus CVCL_0468
In Vivo Model
For FA-induced nephropathy mouse models, 8-week-old male wild-type and Dpep1+/- or Chmp1a+/- mice were injected with FA (250 or 200 mg/kg, dissolved in 300 mM sodium bicarbonate) intraperitoneally and euthanized on day 7. For the cisplatin-induced injury model, 8-week-old male wild-type, Dpep1+/- or Chmp1a+/- mice were injected with cisplatin (25 or 20 mg/kg) intraperitoneally.

    Click to Show/Hide
Response regulation Both Dpep1 and Chmp1a are important regulators of a single pathway, ferroptosis and lead to acute kidney injury development via altering cellular iron trafficking.
References
Ref 1 A single genetic locus controls both expression of DPEP1/CHMP1A and kidney disease development via ferroptosis. Nat Commun. 2021 Aug 23;12(1):5078. doi: 10.1038/s41467-021-25377-x.