Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10099)
Regulator Name Fatty acid-binding protein, adipocyte (FABP4)
Synonyms
Adipocyte lipid-binding protein; Adipocyte-type fatty acid-binding protein; Fatty acid-binding protein 4
    Click to Show/Hide
Gene Name FABP4
Gene ID 2167
Regulator Type Protein coding
Uniprot ID P15090
Sequence
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA

    Click to Show/Hide
Family Fatty-acid binding protein (FABP) family
Function
Lipid transport protein in adipocytes. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus.

    Click to Show/Hide
HGNC ID
HGNC:3559
KEGG ID hsa:2167
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
FABP4 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
LL/2 (LLC1) cells Lung cancer Mus musculus CVCL_4358
HUVECs (Human umbilical vein endothelial cells)
In Vivo Model
For treatment with RSL3 (20 mg/kg), drug was administered in mice bearing LLC tumors by i.p. injection every other day for 2 weeks. For cisplatin, BALB/c mice bearing 4T1 tumors (50-100 mm3) were administered by i.p. injection of vehicle (0.7% DMSO in PBS) or cisplatin (7 mg/kg/week) for 3 weeks.

    Click to Show/Hide
Response regulation SCD1 and FABP4 were also found upregulated in recurrent human breast cancer samples and correlated with worse prognosis of cancer patients with different types of tumors. Mechanistically, SCD1 leads to fatty acid (FA) desaturation and FABP4 derived from TEM enhances lipid droplet (LD) in cancer cells, which cooperatively protect from oxidative stress-induced ferroptosis.
Breast cancer [ICD-11: 2C60]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Fatty acid-binding protein, adipocyte (FABP4) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
LL/2 (LLC1) cells Lung cancer Mus musculus CVCL_4358
HUVECs (Human umbilical vein endothelial cells)
In Vivo Model
For treatment with RSL3 (20 mg/kg), drug was administered in mice bearing LLC tumors by i.p. injection every other day for 2 weeks. For cisplatin, BALB/c mice bearing 4T1 tumors (50-100 mm3) were administered by i.p. injection of vehicle (0.7% DMSO in PBS) or cisplatin (7 mg/kg/week) for 3 weeks.

    Click to Show/Hide
Response regulation SCD1 and FABP4 were also found upregulated in recurrent human breast cancer samples and correlated with worse prognosis of cancer patients with different types of tumors. Mechanistically, SCD1 leads to fatty acid (FA) desaturation and FABP4 derived from TEM enhances lipid droplet (LD) in cancer cells, which cooperatively protect from oxidative stress-induced ferroptosis.
References
Ref 1 Tumor resistance to ferroptosis driven by Stearoyl-CoA Desaturase-1 (SCD1) in cancer cells and Fatty Acid Biding Protein-4 (FABP4) in tumor microenvironment promote tumor recurrence. Redox Biol. 2021 Jul;43:102006. doi: 10.1016/j.redox.2021.102006. Epub 2021 May 14.