Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10025)
Regulator Name Suppressor of cytokine signaling 1 (SOCS1)
Synonyms
SSI1, TIP3 ; JAK-binding protein; STAT-induced STAT inhibitor 1; Tec-interacting protein 3
    Click to Show/Hide
Gene Name SOCS1
Gene ID 8651
Regulator Type Protein coding
Uniprot ID O15524
Sequence
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRS
HADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMA
SGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQ
RIVATVGRENLARIPLNPVLRDYLSSFPFQI

    Click to Show/Hide
Family SOCS1 family
Function
Essential negative regulator of type I and type II interferon (IFN) signaling, as well as that of other cytokines, including IL2, IL4, IL6 and leukemia inhibitory factor (LIF). Downregulates cytokine signaling by inhibiting the JAK/STAT signaling pathway. Acts by binding to JAK proteins and to IFNGR1 and inhibiting their kinase activity. In vitro, suppresses Tec protein-tyrosine activity. Regulates IFN-gamma (IFNG)- mediated sensory neuron survival. Probable substrate recognition component of an ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

    Click to Show/Hide
HGNC ID
HGNC:19383
KEGG ID hsa:8651
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
SOCS1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Osteosarcoma ICD-11: 2B51
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 U2OS cells Osteosarcoma Homo sapiens CVCL_0042
IMR-90 cells Normal Homo sapiens CVCL_0347
Response regulation SOCS1 impacts the pattern of secreted products in cells with active p53 and is required for the expression of a selective set of p53 target genes including those involved in ferroptosis. SOCS1 can use several mechanisms to activate p53, including promotion of serine-15 phosphorylation by ATM/ATR kinases and inhibition of the p53 repressor KAP1 in osteosarcoma cell lines.
Osteosarcoma [ICD-11: 2B51]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Suppressor of cytokine signaling 1 (SOCS1) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 U2OS cells Osteosarcoma Homo sapiens CVCL_0042
IMR-90 cells Normal Homo sapiens CVCL_0347
Response regulation SOCS1 impacts the pattern of secreted products in cells with active p53 and is required for the expression of a selective set of p53 target genes including those involved in ferroptosis. SOCS1 can use several mechanisms to activate p53, including promotion of serine-15 phosphorylation by ATM/ATR kinases and inhibition of the p53 repressor KAP1 in osteosarcoma cell lines.
References
Ref 1 SOCS1 regulates senescence and ferroptosis by modulating the expression of p53 target genes. Aging (Albany NY). 2017 Oct 28;9(10):2137-2162. doi: 10.18632/aging.101306.