Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10023)
Regulator Name Branched-chain-amino-acid aminotransferase, mitochondrial (BCAT2)
Synonyms
Placental protein 18
    Click to Show/Hide
Gene Name BCAT2
Gene ID 587
Regulator Type Protein coding
Uniprot ID O15382
Sequence
MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKT
FTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRP
WLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSL
GVSQPTRALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLV
QQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGVLELVTPPLNGVILPGVVRQS
LLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRILYKDRNLHIP
TMENGPELILRFQKELKEIQYGIRAHEWMFPV

    Click to Show/Hide
Family Class-IV pyridoxal-phosphate-dependent aminotransferase family
Function
Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine. May also function as a transporter of branched chain alpha-keto acids.

    Click to Show/Hide
HGNC ID
HGNC:977
KEGG ID hsa:587
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
BCAT2 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Pancreatic cancer ICD-11: 2C10
 Disease Info 
Responsed Drug Erastin Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Autophagy hsa04140
Cell Process Cell ferroptosis
Cell autophagy
In Vitro Model
 AsPC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Panc02 cells Pancreatic ductal adenocarcinoma Mus musculus CVCL_D627
H22 cells Hepatoma Mus musculus CVCL_H613
HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
SW480 cells Colon adenocarcinoma Homo sapiens CVCL_0546
In Vivo Model
1 x 106 BCAT2 overexpression and control Panc02 cancer cells were implanted subcutaneously into the right dorsal flanks of C57BL/6 mice (five mice per group), respectively. To investigate the role of combination sorafenib with sulfasalazine inducing ferroptosis, 1 x 106 Panc02 were implanted subcutaneously into the right dorsal flanks of C57BL/6 mice. To generate orthotopic tumors, forty C57BL/6 mice were surgically implanted with 1 x 106 H22 cells into left lobe of livers.

    Click to Show/Hide
Response regulation Ferroptosis inducers (erastin, sorafenib, or sulfasalazine) activate ferritinophagy and AMPK phosphorylation, which consequently suppresses nuclear translocation of SREBP1, and inhibits the transcription of its direct target gene BCAT2. BCAT2 is a suppressor of ferroptosis by regulating intracellular glutamate levels in pancreatic ductal adenocarcinoma cells.
Pancreatic cancer [ICD-11: 2C10]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Branched-chain-amino-acid aminotransferase, mitochondrial (BCAT2) Protein coding
 Regulator Info 
Responsed Drug Erastin Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Autophagy hsa04140
Cell Process Cell ferroptosis
Cell autophagy
In Vitro Model
 AsPC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Panc02 cells Pancreatic ductal adenocarcinoma Mus musculus CVCL_D627
H22 cells Hepatoma Mus musculus CVCL_H613
HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
SW480 cells Colon adenocarcinoma Homo sapiens CVCL_0546
In Vivo Model
1 x 106 BCAT2 overexpression and control Panc02 cancer cells were implanted subcutaneously into the right dorsal flanks of C57BL/6 mice (five mice per group), respectively. To investigate the role of combination sorafenib with sulfasalazine inducing ferroptosis, 1 x 106 Panc02 were implanted subcutaneously into the right dorsal flanks of C57BL/6 mice. To generate orthotopic tumors, forty C57BL/6 mice were surgically implanted with 1 x 106 H22 cells into left lobe of livers.

    Click to Show/Hide
Response regulation Ferroptosis inducers (erastin, sorafenib, or sulfasalazine) activate ferritinophagy and AMPK phosphorylation, which consequently suppresses nuclear translocation of SREBP1, and inhibits the transcription of its direct target gene BCAT2. BCAT2 is a suppressor of ferroptosis by regulating intracellular glutamate levels in pancreatic ductal adenocarcinoma cells.
Erastin [Investigative]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Inducer
Response Target Unspecific Target
Responsed Disease Pancreatic cancer ICD-11: 2C10
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Autophagy hsa04140
Cell Process Cell ferroptosis
Cell autophagy
In Vitro Model
 AsPC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Panc02 cells Pancreatic ductal adenocarcinoma Mus musculus CVCL_D627
H22 cells Hepatoma Mus musculus CVCL_H613
HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
SW480 cells Colon adenocarcinoma Homo sapiens CVCL_0546
In Vivo Model
1 x 106 BCAT2 overexpression and control Panc02 cancer cells were implanted subcutaneously into the right dorsal flanks of C57BL/6 mice (five mice per group), respectively. To investigate the role of combination sorafenib with sulfasalazine inducing ferroptosis, 1 x 106 Panc02 were implanted subcutaneously into the right dorsal flanks of C57BL/6 mice. To generate orthotopic tumors, forty C57BL/6 mice were surgically implanted with 1 x 106 H22 cells into left lobe of livers.

    Click to Show/Hide
Response regulation Ferroptosis inducers (erastin, sorafenib, or sulfasalazine) activate ferritinophagy and AMPK phosphorylation, which consequently suppresses nuclear translocation of SREBP1, and inhibits the transcription of its direct target gene BCAT2. BCAT2 is a suppressor of ferroptosis by regulating intracellular glutamate levels in pancreatic ductal adenocarcinoma cells.
References
Ref 1 Branched-chain amino acid aminotransferase 2 regulates ferroptotic cell death in cancer cells. Cell Death Differ. 2021 Apr;28(4):1222-1236. doi: 10.1038/s41418-020-00644-4. Epub 2020 Oct 23.