Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10010)
Regulator Name Insulin-like growth factor 2 mRNA-binding protein 3 (IGF2BP3)
Synonyms
IMP3, KOC1, VICKZ3; IGF-II mRNA-binding protein 3; KH domain-containing protein overexpressed in cancer; VICKZ family member 3
    Click to Show/Hide
Gene Name IGF2BP3
Gene ID 10643
Regulator Type Protein coding
Uniprot ID O00425
Sequence
MNKLYIGNLSENAAPSDLESIFKDAKIPVSGPFLVKTGYAFVDCPDESWALKAIEALSGK
IELHGKPIEVEHSVPKRQRIRKLQIRNIPPHLQWEVLDSLLVQYGVVESCEQVNTDSETA
VVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLGQRGSS
RQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAA
EKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLK
KIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNL
QAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAI
IGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFV
SPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKIT
GHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK

    Click to Show/Hide
Family RRM IMP/VICKZ family
Function
RNA-binding factor that may recruit target transcripts to cytoplasmic protein-RNA complexes (mRNPs). This transcript 'caging' into mRNPs allows mRNA transport and transient storage. It also modulates the rate and location at which target transcripts encounter the translational apparatus and shields them from endonuclease attacks or microRNA-mediated degradation. Preferentially binds to N6- methyladenosine (m6A)-containing mRNAs and increases their stability. Binds to the 3'-UTR of CD44 mRNA and stabilizes it, hence promotes cell adhesion and invadopodia formation in cancer cells. Binds to beta-actin/ACTB and MYC transcripts. Increases MYC mRNA stability by binding to the coding region instability determinant (CRD) and binding is enhanced by m6A-modification of the CRD. Binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs.

    Click to Show/Hide
HGNC ID
HGNC:28868
KEGG ID hsa:10643
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
IGF2BP3 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Fatty acid CoA ligase Acsl3 (ACSL3) [Driver; Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Lung cancer ICD-11: 2C25
 Disease Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 BEAS-2B cells Normal Homo sapiens CVCL_0168
NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
SW1990 cells Pancreatic adenocarcinoma Homo sapiens CVCL_1723
HCT 116 cells Colon carcinoma Homo sapiens CVCL_0291
In Vivo Model
Igf2bp3-/- mice were generated by Cyagen Biosciences (Guangzhou,China). Mettl3-/- mice were obtained as described in our previous study. H1299 cells with or without IGF2BP3 overexpression were digested and adjusted to a density of 5 x 106 cells/200 uL. Next, 200 uL of cells were injected into the right armpit of each 4-6-week-old athymic nude mouse (Jiesijie, Shanghai, China). The weight and tumor size of nude mice were measured. Each group contained five mice. After 2 weeks, mice were injected daily with dimethyl sulfoxide (DMSO, Beyotime Biotechnology, Shanghai, China) with or without imidazole ketone erastin (IKE, 50 mg/kg, MedChemExpress, Monmouth, NJ, USA) or rigosertib (RIG, 250 mg/kg, Selleck, Houston, TX, USA).

    Click to Show/Hide
Response regulation After IGF2BP3 overexpression, expression levels and mRNA stabilities of these anti-ferroptotic factors were successfully sustained. Notably, significant correlations between SLC3A2, ACSL3, and IGF2BP3 were revealed in clinical Lung adenocarcinoma specimens, further establishing the essential role of IGF2BP3 in desensitizing ferroptosis. Inducing ferroptosis has been gradually accepted as an alternative strategy to treat tumors.
Lung cancer [ICD-11: 2C25]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Insulin-like growth factor 2 mRNA-binding protein 3 (IGF2BP3) Protein coding
 Regulator Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 BEAS-2B cells Normal Homo sapiens CVCL_0168
NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
SW1990 cells Pancreatic adenocarcinoma Homo sapiens CVCL_1723
HCT 116 cells Colon carcinoma Homo sapiens CVCL_0291
In Vivo Model
Igf2bp3-/- mice were generated by Cyagen Biosciences (Guangzhou,China). Mettl3-/- mice were obtained as described in our previous study. H1299 cells with or without IGF2BP3 overexpression were digested and adjusted to a density of 5 x 106 cells/200 uL. Next, 200 uL of cells were injected into the right armpit of each 4-6-week-old athymic nude mouse (Jiesijie, Shanghai, China). The weight and tumor size of nude mice were measured. Each group contained five mice. After 2 weeks, mice were injected daily with dimethyl sulfoxide (DMSO, Beyotime Biotechnology, Shanghai, China) with or without imidazole ketone erastin (IKE, 50 mg/kg, MedChemExpress, Monmouth, NJ, USA) or rigosertib (RIG, 250 mg/kg, Selleck, Houston, TX, USA).

    Click to Show/Hide
Response regulation After IGF2BP3 overexpression, expression levels and mRNA stabilities of these anti-ferroptotic factors were successfully sustained. Notably, significant correlations between SLC3A2, ACSL3, and IGF2BP3 were revealed in clinical Lung adenocarcinoma specimens, further establishing the essential role of IGF2BP3 in desensitizing ferroptosis. Inducing ferroptosis has been gradually accepted as an alternative strategy to treat tumors.
References
Ref 1 IGF2BP3 is an essential N(6)-methyladenosine biotarget for suppressing ferroptosis in lung adenocarcinoma cells. Mater Today Bio. 2022 Nov 24;17:100503. doi: 10.1016/j.mtbio.2022.100503. eCollection 2022 Dec 15.