Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10003)
Regulator Name Ferritin
Synonyms
1HCH; FER1; FER1HCH
    Click to Show/Hide
Gene Name Fer1HCH
Gene ID 46415
Regulator Type Protein coding
Uniprot ID B8A405
Sequence
MVKLIASLLLLAVVAQAYGDFKSKQESKSFVRELQREREEHQLKEKQNLSHEGQDQECKG
SLAVPEITKDWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKA
AKEEREHGSKLVEYLSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSI
RKLIQTCENKPYNHYHLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK
TL

    Click to Show/Hide
Family Ferritin family
Function
Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation.

    Click to Show/Hide
KEGG ID dme:Dmel_CG2216
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
Fer1HCH can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Health ICD-11: N.A.
 Disease Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Response regulation There is no excess ROS in discs with reducedwtsactivity, but ifFer1HCHis knocked-down simultaneously, very high ROS levels accumulate in the tissue, suggesting a protective role for the excess Fer1HCH inwtsmutants.
Health [ICD-11: N.A.]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Ferritin Protein coding
 Regulator Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Response regulation There is no excess ROS in discs with reducedwtsactivity, but ifFer1HCHis knocked-down simultaneously, very high ROS levels accumulate in the tissue, suggesting a protective role for the excess Fer1HCH inwtsmutants.
References
Ref 1 Ferritin heavy chain protects the developing wing from reactive oxygen species and ferroptosis. PLoS Genet. 2019 Sep 30;15(9):e1008396. doi: 10.1371/journal.pgen.1008396. eCollection 2019 Sep.