Ferroptosis Target Information
General Information of the Ferroptosis Target (ID: TAR10047)
| Target Name | Mitoferrin-2 (SLC25A28) | ||||
|---|---|---|---|---|---|
| Synonyms |
Mitochondrial RNA-splicing protein 3/4 homolog; Mitochondrial iron transporter 2; Solute carrier family 25 member 28
Click to Show/Hide
|
||||
| Gene Name | SLC25A28 | ||||
| Sequence |
MELEGRGAGGVAGGPAAGPGRSPGESALLDGWLQRGVGRGAGGGEAGACRPPVRQDPDSG
PDYEALPAGATVTTHMVAGAVAGILEHCVMYPIDCVKTRMQSLQPDPAARYRNVLEALWR IIRTEGLWRPMRGLNVTATGAGPAHALYFACYEKLKKTLSDVIHPGGNSHIANGAAGCVA TLLHDAAMNPAEVVKQRMQMYNSPYHRVTDCVRAVWQNEGAGAFYRSYTTQLTMNVPFQA IHFMTYEFLQEHFNPQRRYNPSSHVLSGACAGAVAAAATTPLDVCKTLLNTQESLALNSH ITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPSTAIAWSVYEFFKYLITKRQEEW RAGK Click to Show/Hide
|
||||
| Family | Mitochondrial carrier family | ||||
| Function |
Mitochondrial iron transporter that mediates iron uptake. Probably required for heme synthesis of hemoproteins and Fe-S cluster assembly in non-erythroid cells.
Click to Show/Hide
|
||||
| Gene ID | 81894 | ||||
| Uniprot ID | |||||
| Target Type | Driver Suppressor Marker | ||||
| Mechanism Diagram | Click to View the Original Diagram | ||||
|
|||||
Tissue Relative Abundances of This Target
Full List of Regulator(s) of This Ferroptosis Target and Corresponding Disease/Drug Response(s)
SLC25A28 can be involved in and affect the ferroptosis by the following regulators, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulting from the regulation of certain regulators.
Browse Regulator related Disease
Cellular tumor antigen p53 (TP53)
Liver fibrosis [ICD-11: DB93]
| In total 1 item(s) under this disease | |||||
| Experiment 1 Reporting the Ferroptosis-centered Disease Response of This Regulator | [1] | ||||
| Regulator for Ferroptosis | Driver | ||||
| Pathway Response | Fatty acid metabolism | hsa01212 | |||
| Ferroptosis | hsa04216 | ||||
| Apoptosis | hsa04210 | ||||
| Cell Process | Cell ferroptosis | ||||
| Cell apoptosis | |||||
| Cell proliferation | |||||
In Vitro Model |
hHSCs (Human hepatic stellate cells) | ||||
| HSC-T6 cells | Normal | Rattus norvegicus | CVCL_0315 | ||
| In Vivo Model |
Eight-week-old male C57BL/6 mice were purchased from Nanjing Medical University (Nanjing, China). Sixty mice were randomly divided into six groups of ten animals each with comparable mean body weight. Mice of six groups were treated with Sham, BDL + VA-Lip-Control-shRNA, BDL + VA-Lip-Control-shRNA + erastin, BDL + VA-Lip-BRD7-shRNA + erastin, BDL + VA-Lip-P53-shRNA + erastin or BDL + VA-Lip-SLC25A28-shRNA + erastin, respectively. Mice were anesthetized with isoflurane. A midline laparotomy was performed, and the common bile duct was ligated close to the liver hilus immediately below the bifurcation with 3-0 surgical silk and cut between the ligatures as described previously.
Click to Show/Hide
|
||||
| Response Description | BRD7- P53-SLC25A28 axis involves in mediating ferroptosis via mitochondrial iron metabolism pathway. These findings reveal novel signal transduction and regulatory mechanism of ferroptosis, and also suggest BRD7- P53-SLC25A28 axis as potential targets for liver fibrosis. | ||||
Bromodomain-containing protein 7 (BRD7)
Liver fibrosis [ICD-11: DB93]
| In total 1 item(s) under this disease | |||||
| Experiment 1 Reporting the Ferroptosis-centered Disease Response of This Regulator | [1] | ||||
| Regulator for Ferroptosis | Driver | ||||
| Pathway Response | Fatty acid metabolism | hsa01212 | |||
| Ferroptosis | hsa04216 | ||||
| Apoptosis | hsa04210 | ||||
| Cell Process | Cell ferroptosis | ||||
| Cell apoptosis | |||||
| Cell proliferation | |||||
In Vitro Model |
hHSCs (Human hepatic stellate cells) | ||||
| HSC-T6 cells | Normal | Rattus norvegicus | CVCL_0315 | ||
| In Vivo Model |
Eight-week-old male C57BL/6 mice were purchased from Nanjing Medical University (Nanjing, China). Sixty mice were randomly divided into six groups of ten animals each with comparable mean body weight. Mice of six groups were treated with Sham, BDL + VA-Lip-Control-shRNA, BDL + VA-Lip-Control-shRNA + erastin, BDL + VA-Lip-BRD7-shRNA + erastin, BDL + VA-Lip-P53-shRNA + erastin or BDL + VA-Lip-SLC25A28-shRNA + erastin, respectively. Mice were anesthetized with isoflurane. A midline laparotomy was performed, and the common bile duct was ligated close to the liver hilus immediately below the bifurcation with 3-0 surgical silk and cut between the ligatures as described previously.
Click to Show/Hide
|
||||
| Response Description | BRD7-P53-SLC25A28 axis involves in mediating ferroptosis via mitochondrial iron metabolism pathway. These findings reveal novel signal transduction and regulatory mechanism of ferroptosis, and also suggest BRD7-P53-SLC25A28 axis as potential targets for liver fibrosis. | ||||